P58-Cl42 Kir

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P58-Cl42 Kir
  Conformer 1
(PDB) 		1b6u (A)
  Conformer 2
(PDB) 		1efx (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 99 0.71   69 - 69   101 - 198
2 93 1.5   7 - 68   70 - 100

Sequence


           _______________________________________________________________68_____________________________100_______________________ 
 1b6u(A) : *HRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGES 
         :                                                                                                                          
 1efx(D) : VHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGES 
           _______________________________________________________________68_____________________________100_______________________ 

           ________________________________________________________________________________                                         
 1b6u(A) : VTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNP                                         
         :                                                                                                                          
 1efx(D) : VTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVI***                                         
           ________________________________________________________________________________                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		15.1
Translation
(A) 		1.1
Closure
(%) 		19.5
Bending Residues
( green ) 		  68 - 70
  100 - 101
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download