Polyamine Transport Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Polyamine Transport Protein
  Conformer 1
(PDB) 		3ttm (A)
  Conformer 2
(PDB) 		3ttl (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 29 0.89   130 - 135   270 - 275   324 - 330   334 - 343
2 150 0.86   31 - 129   276 - 323   331 - 333
3 152 0.96   136 - 269   344 - 362

Sequence


           ____________________________________________________________________________________________________128____135__________ 
 3ttm(A) : DNKVLHVYNWSDYIAPDTLEKFTKETGIKVVYDVYDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKV 
         :                                                                                                                          
 3ttl(A) : ***SLHIYNWTDYIAPTTLKDFTKESGIDVSYDVFDSNETLEGKLVSGHSGYDIVVPSNNFLGKQIQAGAFQKLDKSKLPNWKNLDPALLKQLEVSDPGNQYAVPYLWGTNGIGYNVAKV 
           ____________________________________________________________________________________________________127____134__________ 

           ________________________________________________________________________________________________________________________ 
 3ttm(A) : KAAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNI 
         :                                                                                                                          
 3ttl(A) : KEVLGDQ-PIDSWAILFEPENMKKLAKCGVAFMDSGDEMLPAALNYLGLDPNTHDPKDYKKAEEVLTKVRPYVSYFHSSKYISDLANGNICVAFGYSGDVFQAAARAEEAGKGIDIQYVI 
           ________________________________________________________________________________________________________________________ 

           _269___275___________________________________________321______330__________343_______________________                    
 3ttm(A) : PKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQRAMTRSWTKIKSG                    
         :                                                                                                                          
 3ttl(A) : PKEGANLWFDLMAIPADAKAADNAYAFIDYLLRPEVIAKVSDYVGYANAIPGARPLMDKSVSDSEEVYPPQAVLDKLYVSAVLPAKVLRLQTRTWTRIK**                    
           _267___273___________________________________________319______328__________341_______________________                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		20.4
Translation
(A) 		-0.3
Closure
(%) 		53.7
Bending Residues
( green ) 		  128 - 130
  275 - 276
  321 - 324
  330 - 334
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		21.5
Translation
(A) 		0.1
Closure
(%) 		99.7
Bending Residues
( green ) 		  135 - 136
  269 - 270
  343 - 344
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download