Ubiquinol-Cytochrome C Reductase Iron-Sulfur Subunit

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ubiquinol-Cytochrome C Reductase Iron-Sulfur Subunit
  Conformer 1
(PDB) 		8asj (E)
  Conformer 2
(PDB) 		8asi (E)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 139 2.74   46 - 184
2 34 0.38   12 - 45

Sequence


           ___________________________________43___________________________________________________________________________________ 
 8asj(E) : HAGTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMW 
         :                                                                                                                          
 8asi(E) : HAGTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMW 
           ___________________________________43___________________________________________________________________________________ 

           _____________________________________________________________                                                            
 8asj(E) : GVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG                                                            
         :                                                                                                                          
 8asi(E) : GVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG                                                            
           _____________________________________________________________                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		45.1
Translation
(A) 		1.0
Closure
(%) 		82.9
Bending Residues
( green ) 		  43 - 46
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download