Cytidylate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Cytidylate Kinase
  Conformer 1
(PDB) 		1kdo (A)
  Conformer 2
(PDB) 		1cke (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 100 0.8   6 - 37   115 - 149   178 - 223
2 77 0.83   38 - 114
3 28 0.88   150 - 177

Sequence


           _________________________________37_________________________________________________________________________113_________ 
 1kdo(A) : AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRE 
         :                                                                                                                          
 1cke(A) : AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRE 
           _________________________________37_________________________________________________________________________113_________ 

           _______________________148__________________________177__________________________________________________                
 1kdo(A) : LPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLA**                
         :                                                                                                                          
 1cke(A) : LPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNFERLLAEIK-------------lVPAADALVLDSTTLSIEQVIEKALQYARQKLALA                
           _______________________148__________________________177__________________________________________________                

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		31.6
Translation
(A) 		-0.4
Closure
(%) 		99.8
Bending Residues
( green ) 		  37 - 38
  113 - 117
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		32.3
Translation
(A) 		0.6
Closure
(%) 		39.7
Bending Residues
( green ) 		  148 - 150
  177 - 193
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download