Glutamate Receptor 3

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor 3
  Conformer 1
(PDB) 		3dln (A)
  Conformer 2
(PDB) 		3rt6 (B)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 141 0.24   10 - 107   198 - 201   217 - 255
2 106 0.24   108 - 197   202 - 216   256 - 256

Sequence


           _____________________________________________________________________________________________________107________________ 
 3dln(A) : RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 3rt6(B) : RTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           _____________________________________________________________________________________________________107________________ 

           _______________________________________________________________________197_201___________215____________________________ 
 3dln(A) : AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSE 
         :                                                                                                                          
 3rt6(B) : AEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSE 
           _______________________________________________________________________197_201___________215____________________________ 

           _______253________                                                                                                       
 3dln(A) : QGILDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 3rt6(B) : QGILDKLKNKWWYDKGEC                                                                                                       
           _______253________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		1.8
Translation
(A) 		0.2
Closure
(%) 		96.0
Bending Residues
( green ) 		  107 - 108
  197 - 198
  201 - 202
  215 - 219
  253 - 256
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download