Hemoglobin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hemoglobin
  Conformer 1
(PDB) 		1it2 (A)
  Conformer 2
(PDB) 		1it2 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 103 0.41   3 - 33   73 - 144
2 39 0.36   34 - 72

Sequence


           _______________________________33_____________________________________72________________________________________________ 
 1it2(A) : PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSI 
         :                                                                                                                          
 1it2(B) : PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSI 
           ______________________________233____________________________________272________________________________________________ 

           __________________________                                                                                               
 1it2(A) : FVSTIDGGAEFEKLFSIICILLRSAY                                                                                               
         :                                                                                                                          
 1it2(B) : FVSTIDGGAEFEKLFSIICILLRSAY                                                                                               
           __________________________                                                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.5
Translation
(A) 		0.2
Closure
(%) 		0.5
Bending Residues
( green ) 		  33 - 34
  72 - 73
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download