Major Prion Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Major Prion Protein
  Conformer 1
(PDB) 		7lna (A)
  Conformer 2
(PDB) 		7td6 (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 87 3.95   102 - 182   213 - 218
2 27 4.4   183 - 212

Sequence


           ____________________________________________________________________________________180_____________________________212_ 
 7lna(A) : *THNQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHFGNDWEDRYYRENMNRYPNQVYYRPVDQYNNQNNFVHDCVNITIKQHTVTTTT---nFTETDIKIMERVVEQM 
         :                                                                                                                          
 7td6(A) : GTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQM 
           ____________________________________________________________________________________179_____________________________211_ 

           __________________                                                                                                       
 7lna(A) : CTTQYQKESQAYYD****                                                                                                       
         :                                                                                                                          
 7td6(A) : CVTQYQKESQAYYDGRRS                                                                                                       
           __________________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		56.8
Translation
(A) 		-0.8
Closure
(%) 		98.6
Bending Residues
( green ) 		  180 - 183
  212 - 213
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download