Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		2iyq (A)
  Conformer 2
(PDB) 		2iyr (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 104 0.6   4 - 9   15 - 99   136 - 144   160 - 163
2 30 0.92   13 - 14   100 - 110   145 - 159   164 - 165

Sequence


           _______9________________________________________________________________________________________99________110___________ 
 2iyq(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
         :                                                                                                                          
 2iyr(B) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTV--lLA 
           _______9________________________________________________________________________________________99________110___________ 

           ____________________144____________159_163_______                                                                        
 2iyq(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ***                                                                        
         :                                                                                                                          
 2iyr(B) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPS                                                                        
           ____________________144____________159_163_______                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.5
Translation
(A) 		0.1
Closure
(%) 		76.0
Bending Residues
( green ) 		  9 - 15
  99 - 100
  110 - 136
  144 - 145
  159 - 160
  163 - 164
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download