Transcriptional Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator
  Conformer 1
(PDB) 		2yvh (A)
  Conformer 2
(PDB) 		2yve (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 103 1.17   58 - 91   95 - 104   113 - 172
2 61 0.77   6 - 57   92 - 94   105 - 112

Sequence


           _______________________________________________________57______________________________89____________104_____112________ 
 2yvh(A) : ***SKKE-iLRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLG-hELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW 
         :                                                                                                                          
 2yve(A) : MRTSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRDITRDPEDPLERLRAVVVTLAENVSRPELLLLIDAPSHPDFLNAWRTVNHQW 
           _______________________________________________________57______________________________89____________104_____112________ 

           _______________________________________________________                                                                  
 2yvh(A) : IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQA-lETILELIP*                                                                  
         :                                                                                                                          
 2yve(A) : IPDTDDLENDAHKRAVYLVQLAADGLFVHDYIHDDVLSKSKRQAMLETILELIPS                                                                  
           _______________________________________________________                                                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.8
Translation
(A) 		0.7
Closure
(%) 		100.0
Bending Residues
( green ) 		  57 - 58
  89 - 95
  104 - 105
  112 - 113
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download