Probable Dimethyladenosine Transferase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Probable Dimethyladenosine Transferase
  Conformer 1
(PDB) 		1zq9 (A)
  Conformer 2
(PDB) 		1zq9 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 89 0.44   162 - 179   220 - 249   270 - 310
2 161 0.29   38 - 161   180 - 216
3 20 0.3   250 - 269

Sequence


           ________________________________________________________________________________________________________________________ 
 1zq9(A) : QHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILMF 
         :                                                                                                                          
 1zq9(B) : QHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILMF 
           ________________________________________________________________________________________________________________________ 

           ___161_______________179______________________________212_______________________________246___________________268_______ 
 1zq9(A) : QREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADK 
         :                                                                                                                          
 1zq9(B) : QREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAFKSSAVQQLLEKNYRIHCSVHNIIIPEDFSIADK 
           ___161_______________179______________________________212_______________________________246___________________268_______ 

           ______________________________________                                                                                   
 1zq9(A) : IQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS                                                                                   
         :                                                                                                                          
 1zq9(B) : IQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHFS                                                                                   
           ______________________________________                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.2
Translation
(A) 		0.1
Closure
(%) 		76.3
Bending Residues
( green ) 		  161 - 162
  179 - 180
  212 - 220
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		6.3
Translation
(A) 		0.3
Closure
(%) 		90.9
Bending Residues
( green ) 		  246 - 250
  268 - 270
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download