Human Complement Factor H

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Human Complement Factor H
  Conformer 1
(PDB) 		2uwn (A)
  Conformer 2
(PDB) 		2w80 (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 65 0.69   323 - 387
2 54 0.78   388 - 441

Sequence


           _________________________________________________________________387____________________________________________________ 
 2uwn(A) : MGLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPT 
         :                                                                                                                          
 2w80(B) : *TLKPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHIHCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYALPKAQTTVTCMENGWSPT 
           _________________________________________________________________387____________________________________________________ 

           ___________________________________________________________________                                                      
 2uwn(A) : PRCIRVKTCSKSSIDIENGFISESQYTYALKEKAKYQCKLGYVTADGETSGSITCGKDGWSAQPTCI                                                      
         :                                                                                                                          
 2w80(B) : PRCI***************************************************************                                                      
           ___________________________________________________________________                                                      

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.4
Translation
(A) 		-0.1
Closure
(%) 		25.5
Bending Residues
( green ) 		  387 - 388
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download