Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odl (A)
  Conformer 2
(PDB) 		4odm (C)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 91 0.44   3 - 65   121 - 148
2 55 1.05   66 - 120

Sequence


           ______________________________________________________________64_____________________________________________________120 
 4odl(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odm(C) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           ______________________________________________________________64_____________________________________________________120 

           _________________________________                                                                                        
 4odl(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHP***                                                                                        
         :                                                                                                                          
 4odm(C) : LAGKDLDFQVEVVKVREATPEELLHGHAHLVPK                                                                                        
           _________________________________                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.5
Translation
(A) 		-0.4
Closure
(%) 		42.2
Bending Residues
( green ) 		  64 - 66
  120 - 122
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download