Proto-Oncogene Tyrosine-Protein Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proto-Oncogene Tyrosine-Protein Kinase
  Conformer 1
(PDB) 		1opk (A)
  Conformer 2
(PDB) 		2abl  
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 97 1.06   139 - 235
2 54 0.8   85 - 138

Sequence


           ___________________________________________________________136__________________________________________________________ 
 1opk(A) : ********NLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYR 
         :                                                                                                                          
 2abl    : MGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYR 
           ___________________________________________________________136__________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1opk(A) : INTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKH 
         :                                                                                                                          
 2abl    : INTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAP***************************************************************************** 
           ________________________________________________________________________________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 1opk(A) : PNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRNLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNK 
         :                                                                                                                          
 2abl    : ************************************************************************************************************************ 
           ________________________________________________________________________________________________________________________ 

           _________________________________________________________________________________________________                        
 1opk(A) : FSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGK                        
         :                                                                                                                          
 2abl    : *************************************************************************************************                        
           _________________________________________________________________________________________________                        

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		130.6
Translation
(A) 		-3.5
Closure
(%) 		98.0
Bending Residues
( green ) 		  136 - 143
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download