Redox-Sensing Transcriptional Repressor Rex

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Redox-Sensing Transcriptional Repressor Rex
  Conformer 1
(PDB) 		2vt3 (A)
  Conformer 2
(PDB) 		3keo (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 119 2.61   80 - 207
2 62 1.74   13 - 79

Sequence


           _______________________________________________________________________79_______________________________________________ 
 2vt3(A) : ****ATAKRLPLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFGALg-----YNVDYLLSFFRKTLDQD---dVILIGVGNLGTAFLHY------NtKISMAFDINESK-IG 
         :                                                                                                                          
 3keo(A) : SIPKATAKRLSLYYRIFKRFNTDGIEKASSKQIADALGIDSATVRRDFSYFGELGRRGFGYDVKKLMNFFAEILNDHSTTNVMLVGCGNIGRALLHYRFHDRNKMQISMAFDLDSNDLVG 
           _______________________________________________________________________78_______________________________________________ 

           ______________________________________________________________________________________                                   
 2vt3(A) : -TEVGGVPVYNLDDLEQHV-KDESVAILTVPAVAAQSITDRLVALGIKGILNFTPARLNVPEHIRIHHIDLAVELQSLVYFLKHYS                                   
         :                                                                                                                          
 3keo(A) : KTTEDGIPVYGISTINDHLdSDIETAILTVPSTEAQEVADILVKAGIKGILSFSPVHLTLPKDIIVQYVDLTSELQTLLYFMNQQR                                   
           ______________________________________________________________________________________                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		114.7
Translation
(A) 		1.5
Closure
(%) 		32.1
Bending Residues
( green ) 		  79 - 87
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download