Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		2iyw (A)
  Conformer 2
(PDB) 		2iyz (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 133 0.73   9 - 108   129 - 162
2 20 5.77   109 - 128

Sequence


           ____________________________________________________________________________________________________104_________________ 
 2iyw(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
         :                                                                                                                          
 2iyz(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
           ____________________________________________________________________________________________________104_________________ 

           ____128___________________________________________________                                                               
 2iyw(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEH                                                               
         :                                                                                                                          
 2iyz(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNr-NPGAVVRHILSRLQVPS*********                                                               
           ____128___________________________________________________                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		86.0
Translation
(A) 		-2.6
Closure
(%) 		94.0
Bending Residues
( green ) 		  104 - 109
  128 - 130
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download