Trap Periplasmic Solute Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Trap Periplasmic Solute Binding Protein
  Conformer 1
(PDB) 		4ng7 (A)
  Conformer 2
(PDB) 		4x04 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 145 0.79   32 - 105   111 - 150   238 - 279   321 - 325
2 123 0.44   106 - 110   151 - 237   280 - 319

Sequence


           ___________________________________________________________________________105__110_____________________________________ 
 4ng7(A) : **IKAADVHPQGYPNVVAVQKMGEKLKQQ----lEIKVFPGGVLGDEKQMIEQAQIGAIDMIRVSMAPVAAILPDIEVFTLPYVFRDEDHMHKIIDGDIGKSIGDKLT-----rLVFLGW 
         :                                                                                                                          
 4x04(A) : QVIKAADVHPQGYPNVVAVQK-gEKLKQQTDGKLEIKVFPGGVLGDEKQ-iEQAQIGAID-iRVS-aPVAAILPDIEVFTLPYVFRDEDH-hKIIDGDIGKSIGDKLTNNPKSRLVFLGW 
           ___________________________________________________________________________105__110_____________________________________ 

           150____________________________________________________________________________________237______________________________ 
 4ng7(A) : MDSGTRNLITKNPVEKPEDLHGMKIRVQGSPVALDTLKDMGANSVAMGVSEVFSGMQTGVIDGAENNPPTFVAHNYMPVAKNYTLSGHFITPEMLLYSKVKWDKLTADEQQKILTLAREA 
         :                                                                                                                          
 4x04(A) : -dSGTRNLITKNPVEKPEDLHG-kIRVQGSPVALDTLKD-gANSVA-gVSEVFSG-qTGVIDGAENNPPTFVAHNY-pVAKNYTLSGHFITPE-lLYSKVKWDKLTADEQQKILTLAREA 
           150____________________________________________________________________________________237______________________________ 

           _________279____________________________________318_____________                                                         
 4ng7(A) : QFEQRKLWDAYNQEALAKMKAGGVQFHEIDKAYFVKATEPVRAQY---hQALMKAIADVQAENL                                                         
         :                                                                                                                          
 4x04(A) : QFEQRKLWDAYNQEALAK-kAGGVQFHEIDKAYFVKATEPVRAQYGEKHQAL-kAIADVQ****                                                         
           _________279____________________________________318_____________                                                         

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.7
Translation
(A) 		0.4
Closure
(%) 		99.9
Bending Residues
( green ) 		  105 - 106
  110 - 111
  150 - 151
  237 - 238
  279 - 282
  318 - 325
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download