L-Seryl-Trna(sec) Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name L-Seryl-Trna(sec) Kinase
  Conformer 1
(PDB) 		3add (A)
  Conformer 2
(PDB) 		3a4m (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 171 0.69   0 - 173
2 59 0.56   185 - 246

Sequence


           ________________________________________________________________________________________________________________________ 
 3add(A) : HHHlIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNS-rRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGE 
         :                                                                                                                          
 3a4m(A) : DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGE 
           ________________________________________________________________________________________________________________________ 

           _______________________________________________168______________________________________________________________________ 
 3add(A) : KIPNEVIKK-yEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFYVLEENKNKNNNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKeEVDADRVLK 
         :                                                                                                                          
 3a4m(A) : KIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKF-----------nISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKK--vDADRVLK 
           _______________________________________________172______________________________________________________________________ 

           _________                                                                                                                
 3add(A) : EFKDLLNSY                                                                                                                
         :                                                                                                                          
 3a4m(A) : EFKDLLNSY                                                                                                                
           _________                                                                                                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		143.8
Translation
(A) 		-23.2
Closure
(%) 		86.8
Bending Residues
( green ) 		  168 - 186
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download