P58-Cl42 Kir

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P58-Cl42 Kir
  Conformer 1
(PDB) 		1nkr (A)
  Conformer 2
(PDB) 		1efx (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 113 0.76   14 - 18   23 - 25   65 - 68   70 - 71   100 - 198
2 78 1.57   8 - 13   19 - 22   26 - 64   69 - 69   72 - 99

Sequence


           ________13___18__22_25_____________________________________64_________________________________99________________________ 
 1nkr(A) : **RKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGEN 
         :                                                                                                                          
 1efx(D) : VHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGES 
           ________13___18__22_25_____________________________________64_________________________________99________________________ 

           _____________________________________________________________________________                                            
 1nkr(A) : VTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVT                                            
         :                                                                                                                          
 1efx(D) : VTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVI                                            
           _____________________________________________________________________________                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		18.6
Translation
(A) 		0.2
Closure
(%) 		75.0
Bending Residues
( green ) 		  13 - 14
  18 - 19
  22 - 23
  25 - 26
  64 - 72
  99 - 100
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download