Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odm (B)
  Conformer 2
(PDB) 		4odo (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 30 0.3   59 - 71   102 - 105   115 - 127
2 72 0.28   5 - 58   128 - 145
3 29 0.38   72 - 91   106 - 114

Sequence


           ________________________________________________________58___________71__________________91____________________114______ 
 4odm(B) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odo(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           ________________________________________________________58___________71__________________91____________________114______ 

           ____127_______________________                                                                                           
 4odm(B) : LAGKDLDFQVEVVKVREATPEELLHGHAH*                                                                                           
         :                                                                                                                          
 4odo(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHP                                                                                           
           ____127_______________________                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.2
Translation
(A) 		0.4
Closure
(%) 		100.0
Bending Residues
( green ) 		  58 - 59
  127 - 128
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.3
Translation
(A) 		0.1
Closure
(%) 		48.3
Bending Residues
( green ) 		  71 - 72
  91 - 106
  114 - 115
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download