Transcriptional Regulator (Ntrc Family)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator (Ntrc Family)
  Conformer 1
(PDB) 		1ny5 (A)
  Conformer 2
(PDB) 		1ny6 (F)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 102 0.84   161 - 164   174 - 182   191 - 206   228 - 260   267 - 306
2 109 0.77   142 - 160   165 - 173   183 - 190   307 - 379
3 27 1.13   207 - 227   261 - 266

Sequence


           ________________________________________________________________________________________________________________________ 
 1ny5(A) : MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLLPDVNGLEILKWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRK 
         :                                                                                                                          
 1ny6(F) : ************************************************************************************************************************ 
           ________________________________________________________________________________________________________________________ 

           _____________________________________160_164______173______182_____190_194______________________________227_____________ 
 1ny5(A) : LRKENELLRREKDLKEEEYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEI 
         :                                                                                                                          
 1ny6(F) : ****************EEYVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEI 
           _____________________________________160_164______173______182_____190_194______________________________227_____________ 

           ________________259____266_____________________________________306______________________________________________________ 
 1ny5(A) : GELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELK 
         :                                                                                                                          
 1ny6(F) : GELSLEAQAKLLRVIESGKFYRLGGRKEIEVNVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTKSAQELLLSYPWYGNVRELK 
           ________________259____266_____________________________________306______________________________________________________ 

           ________________________                                                                                                 
 1ny5(A) : NVIERAVLFSEGKFIDRGELSCLV                                                                                                 
         :                                                                                                                          
 1ny6(F) : NVIERAVLFSEGKFIDRGELSCLV                                                                                                 
           ________________________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.2
Translation
(A) 		0.3
Closure
(%) 		85.6
Bending Residues
( green ) 		  160 - 161
  164 - 165
  173 - 174
  182 - 183
  190 - 191
  306 - 307
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		16.5
Translation
(A) 		0.3
Closure
(%) 		71.9
Bending Residues
( green ) 		  194 - 207
  227 - 228
  259 - 261
  266 - 271
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download