Transcriptional Regulator

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transcriptional Regulator
  Conformer 1
(PDB) 		3vok (A)
  Conformer 2
(PDB) 		3vp5 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 89 1.79   67 - 105   123 - 184
2 80 0.56   4 - 66   106 - 122

Sequence


           _______________________________________________________________66____________________________________105_________117____ 
 3vok(A) : PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELER 
         :                                                                                                                          
 3vp5(A) : PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELER 
           _______________________________________________________________66____________________________________105_________117____ 

           ____________________________________________________________________                                                     
 3vok(A) : DWK------------dNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRKN                                                     
         :                                                                                                                          
 3vp5(A) : DWKPQSSATVPASENDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITD***                                                     
           ____________________________________________________________________                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		30.6
Translation
(A) 		0.1
Closure
(%) 		61.9
Bending Residues
( green ) 		  66 - 73
  105 - 114
  117 - 138
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download