Hemoglobin S

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hemoglobin S
  Conformer 1
(PDB) 		2hbs (D)
  Conformer 2
(PDB) 		2hhb (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 121 0.28   20 - 20   23 - 23   26 - 144
2 21 0.35   3 - 19   21 - 22   24 - 25

Sequence


           _________________19_____________________________________________________________________________________________________ 
 2hbs(D) : VHLTPVEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGK 
         :                                                                                                                          
 2hhb(D) : VHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGK 
           _________________19_____________________________________________________________________________________________________ 

           __________________________                                                                                               
 2hbs(D) : EFTPPVQAAYQKVVAGVANALAHKYH                                                                                               
         :                                                                                                                          
 2hhb(D) : EFTPPVQAAYQKVVAGVANALAHKYH                                                                                               
           __________________________                                                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.8
Translation
(A) 		0.0
Closure
(%) 		94.0
Bending Residues
( green ) 		  19 - 26
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download