Hera

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hera
  Conformer 1
(PDB) 		3eas (A)
  Conformer 2
(PDB) 		3eaq (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 167 1.03   215 - 383
2 34 0.58   384 - 417

Sequence


           ________________________________________________________________________________________________________________________ 
 3eas(A) : **YEEEAVPAPVRGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTG 
         :                                                                                                                          
 3eaq(A) : VTYEEEAVPAPVRGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTG 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________377__________________________________________                                 
 3eas(A) : RArGGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAALLALLL                                 
         :                                                                                                                          
 3eaq(A) : RA-gGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAALLALLL                                 
           ___________________________________________377__________________________________________                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		11.2
Translation
(A) 		-4.1
Closure
(%) 		84.1
Bending Residues
( green ) 		  377 - 384
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download