Ig Gamma-1 Chain C Region

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ig Gamma-1 Chain C Region
  Conformer 1
(PDB) 		4b7i (A)
  Conformer 2
(PDB) 		4j12 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 58 0.4   241 - 262   275 - 286   304 - 304   306 - 322   332 - 337
2 41 0.55   239 - 240   263 - 274   287 - 303   305 - 305   323 - 331
3 98 0.52   344 - 441

Sequence


           __240___________________262_________274_________286______________303________________322_____330____337__________________ 
 4b7i(A) : *GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR 
         :                                                                                                                          
 4j12(A) : GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR 
           __240___________________262_________274_________286______________303________________322_____330____337__________________ 

           _________________________________________________________________________________________                                
 4b7i(A) : DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKATPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS                                
         :                                                                                                                          
 4j12(A) : EEMTKNQVNLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLNSTLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS                                
           _________________________________________________________________________________________                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.7
Translation
(A) 		-0.1
Closure
(%) 		58.7
Bending Residues
( green ) 		  240 - 241
  262 - 263
  274 - 275
  286 - 287
  303 - 306
  322 - 323
  330 - 332
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		19.8
Translation
(A) 		-0.6
Closure
(%) 		4.1
Bending Residues
( green ) 		  337 - 344
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download