Kinesin Light Chain 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Kinesin Light Chain 2
  Conformer 1
(PDB) 		3zfw (B)
  Conformer 2
(PDB) 		3ceq (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 155 1.74   300 - 301   306 - 475
2 66 0.6   238 - 299   302 - 305

Sequence


           ______________________________________________________________________________________299_______________________________ 
 3zfw(B) : *************************HPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNL 
         :                                                                                                                          
 3ceq(B) : LVPRGSAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNL 
           ______________________________________________________________________________________299_______________________________ 

           ________________________________________________________________________________________________________________________ 
 3zfw(B) : ALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGENKPIWMHAEEREESk-----------------ACKVDSPTVNT 
         :                                                                                                                          
 3ceq(B) : ALLCQNQGKAEEVEYYYRRALEIYATRLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTRAHEKEFGSVNGDNKPIWMHAEEREESKDKRRDSAPYGEYGSWYKACKVDSPTVNT 
           ________________________________________________________________________________________________________________________ 

           _____________________________                                                                                            
 3zfw(B) : TLRSLGALYRRQGKLEAAHTLEDCASR**                                                                                            
         :                                                                                                                          
 3ceq(B) : TLRSLGALYRRQGKLEAAHTLEDCASRNR                                                                                            
           _____________________________                                                                                            

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		19.9
Translation
(A) 		0.0
Closure
(%) 		99.3
Bending Residues
( green ) 		  299 - 306
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download