Periplasmic Chelated Iron-Binding Protein Yfea

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Periplasmic Chelated Iron-Binding Protein Yfea
  Conformer 1
(PDB) 		6q1c (A)
  Conformer 2
(PDB) 		6q1d (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 201 0.78   42 - 201   210 - 219   258 - 260   282 - 309
2 54 1.39   202 - 209   220 - 257   261 - 281

Sequence


           ________________________________________________________________________________________________________________________ 
 6q1c(A) : **KKFKVVTTFTIIQDIAQNIAGDVAVVESITKPGAEIHDYQPTPRDIVKAQSADLILWNGMNLERWFEKFFESIKDVPSAVVTAGITPLPIREGPYSGIANPHAWMSPSNALIYIENIR 
         :                                                                                                                          
 6q1d(A) : TAKKFKVVTTFTIIQDIAQNIAGDVAVVESITKPGAEIHDYQPTPRDIVKAQSADLILWNGMNLERWFEKFFESIKDVPSAVVTAGITPLPIREGPYSGIANPHAWMSPSNALIYIENIR 
           ________________________________________________________________________________________________________________________ 

           _____________________________________197______206_________218____________________________________257____________________ 
 6q1c(A) : KALVEHDPAHAETYNRNAQAYAEKIKALDAPLRERLSRIPAEQRWLVTSEGAFSYLAKDYGFKEVYLW-------------rHVIDIIRENKIPVVFSESTISDKPAKQVSKETGAQYGG 
         :                                                                                                                          
 6q1d(A) : KALVEHDPAHAETYNRNAQAYAEKIKALDAPLRERLSRIPAEQRWLVTSEGAFSYLAKDYGFKEVYLWPINAEQQGIPQQVRHVIDIIRENKIPVVFSESTISDKPAKQVSKETGAQYGG 
           _____________________________________197______206_________218____________________________________257____________________ 

           _281______________________________                                                                                       
 6q1c(A) : VLYVDSLSGEKGPVPTYISLINMTVDTIAKGFGQ                                                                                       
         :                                                                                                                          
 6q1d(A) : VLYVDSLSGEKGPVPTYISLINMTVDTIAKGFGQ                                                                                       
           _281______________________________                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.6
Translation
(A) 		-0.8
Closure
(%) 		73.7
Bending Residues
( green ) 		  197 - 202
  206 - 210
  218 - 220
  257 - 261
  281 - 282
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download