Superoxide Dismutase [Mn/fe] 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Superoxide Dismutase [Mn/fe] 1
  Conformer 1
(PDB) 		5n56 (A)
  Conformer 2
(PDB) 		5n57 (A)
  Window Length 9
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 149 0.46   6 - 37   72 - 188
2 34 0.77   38 - 71

Sequence


           __________________________________37________________________________71__________________________________________________ 
 5n56(A) : AFELPKLPYAFDALEPHFDKETMEIHHDRHHNTYVTKLNAAVEGTDLESKSIEEIVANLDSVPANIQTAVRNNGGGHLNHSLFWELLSPNSEEKGTVVEKIKEQWGSLEEFKKEFADKAA 
         :                                                                                                                          
 5n57(A) : AFKLPNLPYAYDALEPYIDQRTMEFHHDKHHNTYVTKLNATVEGTELEHQSLADMIANLDKVPEAMRMSVRNNGGGHFNHSLFWEILSPNSEEKGGVIDDIKAQWGTLDEFKNEFANKAT 
           __________________________________37________________________________71__________________________________________________ 

           ______________________________________________________________________________                                           
 5n56(A) : ARFGSGWAWLVVNNGQLEIVTTPNQDNPLTEGKTPILGLDVWEHAYYLKYQNKRPDYIGAFWNVVNWEKVDELYNATK                                           
         :                                                                                                                          
 5n57(A) : TLFGSGWTWLVVNDGKLEIVTTPNQDNPLTEGKTPILLFDVWEHAYYLKYQNKRPDYMTAFWNIVNWKKVDELYQAAK                                           
           ______________________________________________________________________________                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.0
Translation
(A) 		-0.6
Closure
(%) 		85.2
Bending Residues
( green ) 		  37 - 39
  71 - 74
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download