Beta-Phosphoglucomutase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Beta-Phosphoglucomutase
  Conformer 1
(PDB) 		2wf5 (A)
  Conformer 2
(PDB) 		5o6p (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 142 0.66   4 - 17   46 - 48   84 - 215
2 63 0.79   18 - 45   49 - 83

Sequence


           ___________13______________________________45_48_________________________________83_____________________________________ 
 2wf5(A) : MFKAVLFDLDGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
         :                                                                                                                          
 5o6p(A) : *FKAVLFDLNGVITDTAEYHFRAWKALAEEIGINGVDRQFNEQLKGVSREDSLQKILDLADKKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASKNGP 
           ___________13______________________________45_48_________________________________83_____________________________________ 

           __________________________________________________________________________________________________                       
 2wf5(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVIVPDTSHYTLEFLKEVWLQ                       
         :                                                                                                                          
 5o6p(A) : FLLERMNLTGYFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGR-------iVIVPDTSHYTLEFLKEVWL*                       
           __________________________________________________________________________________________________                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		13.6
Translation
(A) 		-0.6
Closure
(%) 		87.6
Bending Residues
( green ) 		  13 - 18
  45 - 46
  48 - 49
  83 - 84
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download