3-Deoxy-D-Manno-2-Octulosonic Acid Transferase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name 3-Deoxy-D-Manno-2-Octulosonic Acid Transferase
  Conformer 1
(PDB) 		2xci (A)
  Conformer 2
(PDB) 		2xcu (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 184 0.23   4 - 164   275 - 277   330 - 349
2 162 0.39   165 - 274   278 - 329

Sequence


           ________________________________________________________________________________________________________________________ 
 2xci(A) : RHMQFEVLKRFFPKESLKNCKGALWVHTASIGEFNTFLPILKELKREHRILLTYFSPRAREYLKTKSDFYDCLHPLPLDNPFSVKRFEELSKPKALIVVEREFWPSLIIFTKVPKILVNA 
         :                                                                                                                          
 2xcu(B) : **MQFEVLKRFFPKESLKNCKGALWVHTASIGEFNTFLPILKELKREHRILLTYFSPRAREYLKTKSDFYDCLHPLPLDNPFSVKRFEELSKPKALIVVEREFWPSLIIFTKVPKILVNA 
           ________________________________________________________________________________________________________________________ 

           ___________________________________________164__________________________________________________________________________ 
 2xci(A) : YAKGSLIEKILSKKFDLIIMRTQEDVEKFKTFGAKRVFSCGNLKFICQKGKGIKLKGEFIVAGSIHTGEVEIILKAFKEIKKTYSSLKLILVPRHIENAKIFEKKARDFGFKTSFFENLE 
         :                                                                                                                          
 2xcu(B) : YAKGSLIEKILSKKFDLIIMRTQEDVEKFKTFGAKRVFSCGNLKFICQKGKGIKLKGEFIVAGSIHTGEVEIILKAFKEIKKTYSSLKLILVPRHIENAKIFEKKARDFGFKTSFFENLE 
           ___________________________________________164__________________________________________________________________________ 

           _________________________________274__________________________________________________327_________________________       
 2xci(A) : GDVILVDRFGILKELYPVGKIAIVGGTFVNIGGHNLLEPTCWGIPVIYGPYTHKVNDLKEFLEKEGAGFEVKNETELVTKLTELLSVKKEIKVEEKSREIKGCYLEKLREFLRG       
         :                                                                                                                          
 2xcu(B) : GDVILVDRFGILKELYPVGKIAIVGGTFVNIGGHNLLEPTCWGIPVIYGPYTHKVNDLKEFLEKEGAGFEVKNETELVTKLTELLSVKKEIKVEEKSREIKGCYLEKLREFLRG       
           _________________________________274__________________________________________________327_________________________       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		3.1
Translation
(A) 		0.1
Closure
(%) 		34.6
Bending Residues
( green ) 		  164 - 165
  274 - 275
  277 - 278
  327 - 336
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download