Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1s7y (A)
  Conformer 2
(PDB) 		1yae (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 142 0.68   5 - 106   196 - 196   200 - 202   216 - 251
2 102 0.67   107 - 195   197 - 199   203 - 215

Sequence


           ______________________________________________________________________________________________________________106_______ 
 1s7y(A) : *********NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI 
         :                                                                                                                          
 1yae(A) : PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI 
           ______________________________________________________________________________________________________________533_______ 

           _____________________________________________________________________________193______202__________215__________________ 
 1s7y(A) : LYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI 
         :                                                                                                                          
 1yae(A) : LYRK---iDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI 
           _____________________________________________________________________________740______749__________762__________________ 

           ________________________                                                                                                 
 1s7y(A) : AILQLQEEGKLHMMKEKWWR****                                                                                                 
         :                                                                                                                          
 1yae(A) : AILQLQEEGKLHMMKEKWWRGNGC                                                                                                 
           ________________________                                                                                                 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.3
Translation
(A) 		-0.2
Closure
(%) 		95.9
Bending Residues
( green ) 		  106 - 107
  193 - 200
  202 - 203
  215 - 216
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download