Multiple Antibiotic Resistance Protein Marr

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Multiple Antibiotic Resistance Protein Marr
  Conformer 1
(PDB) 		5h3r (A)
  Conformer 2
(PDB) 		3vod (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 82 0.73   33 - 114
2 47 1.12   14 - 32   115 - 142

Sequence


           ___________________________32_______________________________________________________________________________114_________ 
 5h3r(A) : TSDLFNEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQEL 
         :                                                                                                                          
 3vod(A) : *****NEIIPLGRLIHMVNQKKDRLLNEYLSPLDITAAQFKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVSKGWVERLPNPNDKRGVLVKLTTGGAAICEQCHQLVGQDLHQEL 
           ___________________________32_______________________________________________________________________________114_________ 

           _____________________                                                                                                    
 5h3r(A) : TKNLTADEVATLEYLLKKVLP                                                                                                    
         :                                                                                                                          
 3vod(A) : TKNLTADEVATLEYLLKKVLP                                                                                                    
           _____________________                                                                                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		28.1
Translation
(A) 		-0.5
Closure
(%) 		8.6
Bending Residues
( green ) 		  32 - 36
  114 - 115
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download