Orotidine 5'-Phosphate Decarboxylase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Orotidine 5'-Phosphate Decarboxylase
  Conformer 1
(PDB) 		3gdm (B)
  Conformer 2
(PDB) 		1dqx (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 169 0.6   5 - 59   66 - 91   116 - 119   128 - 131   147 - 147   168 - 169   173 - 260
2 76 0.87   60 - 65   92 - 115   120 - 127   132 - 146   148 - 167   170 - 172

Sequence


           _________________________________________________________59____65________________________91_____________________115_119_ 
 3gdm(B) : **KATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRRFADIGNTVKLQYSAGVYRIAEWADITN 
         :                                                                                                                          
 1dqx(A) : MHKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELLELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQYSAGVYRIAEWADITN 
           _________________________________________________________59____65________________________91_____________________115_119_ 

           ____127________________146__________________167__172____________________________________________________________________ 
 3gdm(B) : AHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLATGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGL-----------rTVDDVVSTGSDIIIVGRGLFAK 
         :                                                                                                                          
 1dqx(A) : AHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRGLFAK 
           ____127________________146__________________167__172____________________________________________________________________ 

           ___________________________                                                                                              
 3gdm(B) : GRDAKVEGERYRKAGWEAYLRR*****                                                                                              
         :                                                                                                                          
 1dqx(A) : GRDAKVEGERYRKAGWEAYLRRCGQQD                                                                                              
           ___________________________                                                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.1
Translation
(A) 		0.2
Closure
(%) 		99.9
Bending Residues
( green ) 		  59 - 60
  65 - 66
  91 - 92
  115 - 116
  119 - 120
  127 - 128
  130 - 132
  146 - 148
  167 - 170
  172 - 176
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download