Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odn (A)
  Conformer 2
(PDB) 		4odo (C)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 28 0.69   15 - 22   62 - 70   103 - 103   116 - 125
2 70 0.44   4 - 14   24 - 61   127 - 147
3 29 0.48   71 - 89   106 - 115

Sequence


           ____________14______22_________________________________57___________70_________________89_______________________115_____ 
 4odn(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odo(C) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           ____________14______22_________________________________57___________70_________________89_______________________115_____ 

           __125____________________________                                                                                        
 4odn(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHP***                                                                                        
         :                                                                                                                          
 4odo(C) : LAGKDLDFQVEVVKVREATPEELLHGHAHPSGH                                                                                        
           __125____________________________                                                                                        

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		9.0
Translation
(A) 		0.0
Closure
(%) 		72.0
Bending Residues
( green ) 		  14 - 15
  22 - 24
  57 - 63
  125 - 128
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		13.0
Translation
(A) 		-0.9
Closure
(%) 		92.1
Bending Residues
( green ) 		  70 - 71
  89 - 106
  115 - 116
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download