Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		1u8a (A)
  Conformer 2
(PDB) 		1l4y (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 126 0.53   4 - 31   35 - 36   64 - 78   82 - 164
2 33 0.43   32 - 34   37 - 63   79 - 81

Sequence


           ____________________________31_34___________________________63_____________78_81________________________________________ 
 1u8a(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGG--vRPLLA 
         :                                                                                                                          
 1l4y(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
           ____________________________31_34___________________________63_____________78_81________________________________________ 

           _____________________________________________                                                                            
 1u8a(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL                                                                            
         :                                                                                                                          
 1l4y(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRL                                                                            
           _____________________________________________                                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		6.2
Translation
(A) 		0.2
Closure
(%) 		75.8
Bending Residues
( green ) 		  31 - 32
  34 - 37
  63 - 64
  78 - 79
  81 - 82
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download