Transforming Protein P21/h-Ras-1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Transforming Protein P21/h-Ras-1
  Conformer 1
(PDB) 		1he8 (B)
  Conformer 2
(PDB) 		1xcm (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 131 1.12   8 - 20   41 - 159
2 20 3.26   21 - 40

Sequence


           __________________20__________________40________________________________________________________________________________ 
 1he8(B) : MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL 
         :                                                                                                                          
 1xcm(A) : MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAAQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNK-dL 
           __________________20__________________40________________________________________________________________________________ 

           _______________________________________________                                                                          
 1he8(B) : AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH*                                                                          
         :                                                                                                                          
 1xcm(A) : AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHK                                                                          
           _______________________________________________                                                                          

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		33.7
Translation
(A) 		-0.2
Closure
(%) 		90.7
Bending Residues
( green ) 		  20 - 22
  40 - 42
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download