Glutamate Receptor, Ionotropic Kainate 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor, Ionotropic Kainate 1
  Conformer 1
(PDB) 		2f36 (A)
  Conformer 2
(PDB) 		4bdm (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 142 0.7   7 - 110   191 - 192   213 - 249
2 100 0.44   111 - 190   193 - 212

Sequence


           _______________________________________________________________________________________________________110______________ 
 2f36(A) : TLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSAD 
         :                                                                                                                          
 4bdm(A) : SLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQ-DnGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSAPFMTLGISILYRKGTPIDSAD 
           _______________________________________________________________________________________________________538______________ 

           _______________________________________________________________190___________________212________________________________ 
 2f36(A) : DLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLH 
         :                                                                                                                          
 4bdm(A) : DLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLH 
           _______________________________________________________________738___________________760________________________________ 

           ______________                                                                                                           
 2f36(A) : MMKEKWWRGNGCPS                                                                                                           
         :                                                                                                                          
 4bdm(A) : MMKEKWW*******                                                                                                           
           ______________                                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.5
Translation
(A) 		0.3
Closure
(%) 		85.3
Bending Residues
( green ) 		  110 - 111
  190 - 193
  212 - 214
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download