Hth-Type Transcriptional Regulator Benm

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hth-Type Transcriptional Regulator Benm
  Conformer 1
(PDB) 		2f7a (A)
  Conformer 2
(PDB) 		2f7a (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 102 1.14   162 - 249   254 - 267
2 101 0.82   92 - 161   250 - 253   268 - 294

Sequence


           ___________________________________________________________________________161__________________________________________ 
 2f7a(A) : RIASVEKTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNF 
         :                                                                                                                          
 2f7a(B) : ******KTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKRTLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNF 
           ___________________________________________________________________________161__________________________________________ 

           ___________________________________________249_253___________267____________________________________________             
 2f7a(A) : STHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNWLEHHHHH             
         :                                                                                                                          
 2f7a(B) : STHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPP*********             
           ___________________________________________249_253___________267____________________________________________             

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.2
Translation
(A) 		0.2
Closure
(%) 		88.8
Bending Residues
( green ) 		  161 - 162
  249 - 250
  253 - 254
  267 - 268
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download