Occludin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Occludin
  Conformer 1
(PDB) 		3g7c (A)
  Conformer 2
(PDB) 		1xaw (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 61 0.42   419 - 450   492 - 520
2 41 0.56   451 - 491

Sequence


           ________________________________448________________________________________491_______________________________            
 3g7c(A) : EEWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGDADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT            
         :                                                                                                                          
 1xaw(A) : **WIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSVLDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT            
           ________________________________448________________________________________491_______________________________            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.9
Translation
(A) 		-0.4
Closure
(%) 		94.5
Bending Residues
( green ) 		  448 - 454
  491 - 495
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download