Putative Repressor Simreg2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Putative Repressor Simreg2
  Conformer 1
(PDB) 		2y30 (A)
  Conformer 2
(PDB) 		3zql (A)
  Window Length 13
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 161 1.71   32 - 169   211 - 211   213 - 213   215 - 215   217 - 236
2 44 1.61   170 - 210   212 - 212   214 - 214   216 - 216

Sequence


           ________________________________________________________________________________________________________________________ 
 2y30(A) : *************EPVSIWMlSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHP 
         :                                                                                                                          
 3zql(A) : VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAELGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANEKRALWLRHPWLATAWRNGHP 
           ________________________________________________________________________________________________________________________ 

           ________________________________________169___________________________________207_______________________________________ 
 2y30(A) : VWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLDRLSP 
         :                                                                                                                          
 3zql(A) : VWGPNSLRQQEFVLGTLGVFDLQVDELLSLIGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYPMFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLD**** 
           ________________________________________169___________________________________207_______________________________________ 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		18.1
Translation
(A) 		-0.4
Closure
(%) 		74.6
Bending Residues
( green ) 		  169 - 171
  207 - 222
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download