Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1ftm (A)
  Conformer 2
(PDB) 		1fto (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 39 0.4   109 - 110   114 - 118   181 - 186   192 - 214   216 - 218
2 143 0.36   7 - 108   219 - 259
3 71 0.42   111 - 113   119 - 180   187 - 191   215 - 215

Sequence


           ______________________________________________________________________________________________________108__113__118_____ 
 1ftm(A) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1fto(B) : *TVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           ______________________________________________________________________________________________________108__113__118_____ 

           _____________________________________________________179____186__191______________________216___________________________ 
 1ftm(A) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1fto(B) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _____________________________________________________179____186__191______________________216___________________________ 

           __________________                                                                                                       
 1ftm(A) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1fto(B) : QGLLDKLKNKWWYDKGEC                                                                                                       
           __________________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		12.4
Translation
(A) 		0.4
Closure
(%) 		88.4
Bending Residues
( green ) 		  108 - 109
  216 - 220
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		6.8
Translation
(A) 		-0.2
Closure
(%) 		97.0
Bending Residues
( green ) 		  110 - 111
  113 - 114
  118 - 119
  179 - 181
  186 - 187
  191 - 193
  214 - 218
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download