Glutaredoxin Mutant With Val 15 Replaced By Gly And Tyr 16 3 Replaced By Pro (V15g,y16p)

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutaredoxin Mutant With Val 15 Replaced By Gly And Tyr 16 3 Replaced By Pro (V15g,y16p)
  Conformer 1
(PDB) 		1aba  
  Conformer 2
(PDB) 		1aaz (B)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 28 0.32   6 - 22   36 - 46
2 26 0.33   23 - 35   68 - 80

Sequence


           ____________________22___________35_________46_________________________________________                                  
 1aba    : MFKVYGYDSNIHKCGPCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK                                  
         :                                                                                                                          
 1aaz(B) : MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK                                  
           ____________________22___________35_________46_________________________________________                                  

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		4.0
Translation
(A) 		0.1
Closure
(%) 		17.2
Bending Residues
( green ) 		  22 - 23
  35 - 36
  46 - 69
Bending Region Analysis

Dynamic Contact Graph

The dynamic contact graph is still being generated. Progress: Initialising

PyMOL Script

Download and extract PyMOL PML script file Download