Hera

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Hera
  Conformer 1
(PDB) 		3eas (B)
  Conformer 2
(PDB) 		3eaq (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 160 1.27   213 - 372
2 45 0.94   373 - 417

Sequence


           ________________________________________________________________________________________________________________________ 
 3eas(B) : VTYEEEAVPAPVRGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTG 
         :                                                                                                                          
 3eaq(B) : VTYEEEAVPAPVRGRLEVLSDLLYVASPDRAMVFTRTKAETEEIAQGLLRLGHPAQALHGDLSQGERERVLGAFRQGEVRVLVATDVAARGLDIPQVDLVVHYRLPDRAEAYQHRSGRTG 
           ________________________________________________________________________________________________________________________ 

           _______________________________________372_______________________________________________                                
 3eas(B) : RAGRGGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAALLALLL                                
         :                                                                                                                          
 3eaq(B) : RAGRGGRVVLLYGPRERRDVEALERAVGRRFKRVNPPTPEEVLEAKWRHLLARLARVPEKDYRLYQDFAGRLFAEGRVEVVAALLALLL                                
           _______________________________________372_______________________________________________                                

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		26.4
Translation
(A) 		-0.2
Closure
(%) 		78.9
Bending Residues
( green ) 		  372 - 373
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download