Interleukin-3 Receptor Subunit Alpha

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Interleukin-3 Receptor Subunit Alpha
  Conformer 1
(PDB) 		4jzj (C)
  Conformer 2
(PDB) 		4jzj (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 114 1.07   99 - 206   226 - 234
2 72 0.44   27 - 98
3 57 1.67   207 - 225   235 - 287

Sequence


           ________________________________________________________________________97______________________________________________ 
 4jzj(C) : NPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN---pWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVA 
         :                                                                                                                          
 4jzj(D) : *PPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVA 
           ________________________________________________________________________97______________________________________________ 

           ____________________________________________________________206___________225______234__________________________________ 
 4jzj(C) : KRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKsFMHWKMRSHFNRKFRYELQIQvITEQVRDRTSFQLLNPtVQIRARER 
         :                                                                                                                          
 4jzj(D) : KRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKsFMHWKMRSHFNRKFRYELQIQvITEQVRDRTSFQLy--TVQIRARER 
           ____________________________________________________________206___________225______234__________________________________ 

           ______________                                                                                                           
 4jzj(C) : VYEFLSAWSTPQR*                                                                                                           
         :                                                                                                                          
 4jzj(D) : VYEFLSAWSTPQRF                                                                                                           
           ______________                                                                                                           

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		41.8
Translation
(A) 		-0.7
Closure
(%) 		99.8
Bending Residues
( green ) 		  97 - 104
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		20.4
Translation
(A) 		0.0
Closure
(%) 		0.5
Bending Residues
( green ) 		  206 - 207
  225 - 226
  234 - 235
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download