Orphan Nuclear Receptor Nr5a2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Orphan Nuclear Receptor Nr5a2
  Conformer 1
(PDB) 		1pk5 (A)
  Conformer 2
(PDB) 		1yuc (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 155 0.76   323 - 329   360 - 409   411 - 412   457 - 552
2 20 0.44   330 - 349
3 45 0.93   410 - 410   413 - 456

Sequence


           _________329________________348__________________________________________________________409____________________________ 
 1pk5(A) : ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQSNRNRQEKLSAFGLLCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVAHGKEGTIFLVTGEHVDYSTIIS 
         :                                                                                                                          
 1yuc(A) : ASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIAS 
           _________310________________329__________________________________________________________390____________________________ 

           ________________456_____________________________________________________________________________________________________ 
 1pk5(A) : HTEVAFNNLLSLAQELVVRLRSLQFDQREFVCLKFLVLFSSDVKNLENLQLVEGVQEQVNAALLDYTVCNYPQQTEKFGQLLLRLPELRAISKQAEDYLYYKHVNGDVPYNNLLIEMLHA 
         :                                                                                                                          
 1yuc(A) : QAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHA 
           ________________437_____________________________________________________________________________________________________ 

           __                                                                                                                       
 1pk5(A) : KR                                                                                                                       
         :                                                                                                                          
 1yuc(A) : **                                                                                                                       
           __                                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		18.6
Translation
(A) 		-0.3
Closure
(%) 		58.2
Bending Residues
( green ) 		  329 - 330
  348 - 362
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		8.4
Translation
(A) 		-0.6
Closure
(%) 		73.5
Bending Residues
( green ) 		  409 - 413
  456 - 457
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download