Shikimate Kinase

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Shikimate Kinase
  Conformer 1
(PDB) 		2iyq (A)
  Conformer 2
(PDB) 		2iyv (A)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 132 0.88   9 - 108   129 - 160
2 20 5.76   109 - 128

Sequence


           ______________________________________________________________________________________________________106_______________ 
 2iyq(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
         :                                                                                                                          
 2iyv(A) : APKAVLVGLPGSGKSTIGRRLAKALGVGLLDTDVAIEQRTGRSIADIFATDGEQEFRRIEEDVVRAALADHDGVLSLGGGAVTSPGVRAALAGHTVVYLEISAAEGVRRTGGNTVRPLLA 
           ______________________________________________________________________________________________________106_______________ 

           ____128____________________________________________________                                                              
 2iyq(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQ*************                                                              
         :                                                                                                                          
 2iyv(A) : GPDRAEKYRALMAKRAPLYRRVATMRVDTNRRNPGAVVRHILSRLQVPSPSEAATLEHh                                                              
           ____128____________________________________________________                                                              

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		90.4
Translation
(A) 		-2.3
Closure
(%) 		97.7
Bending Residues
( green ) 		  106 - 109
  128 - 130
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download