Troponin C

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Troponin C
  Conformer 1
(PDB) 		1avs (A)
  Conformer 2
(PDB) 		1top (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 49 1.92   9 - 38   67 - 85
2 28 1.49   39 - 66

Sequence


           ____________________________________38__________________________66______________________________________________________ 
 1avs(A) : ******QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK********************************* 
         :                                                                                                                          
 1top(A) : ASMTDQQAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELANCFRIFDKNADGFIDIEELGE 
           ____________________________________38__________________________66______________________________________________________ 

           __________________________________________                                                                               
 1avs(A) : ******************************************                                                                               
         :                                                                                                                          
 1top(A) : ILRATGEHVTEEDIEDLMKDSDKNNDGRIDFDEFLKMMEGVQ                                                                               
           __________________________________________                                                                               

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		60.0
Translation
(A) 		3.0
Closure
(%) 		97.4
Bending Residues
( green ) 		  38 - 41
  66 - 71
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download