Molybdate/tungstate Abc Transporter, Atp-Binding Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Molybdate/tungstate Abc Transporter, Atp-Binding Protein
  Conformer 1
(PDB) 		2onk (A)
  Conformer 2
(PDB) 		2onk (B)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 21 0.03   45 - 65
2 42 0.01   3 - 44
3 170 0.08   69 - 238

Sequence


           __________________________________________44___________________65_______________________________________________________ 
 2onk(A) : MFLKVRAEKRLGNFRLNVDFEMGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERRGIGFVPQDYALFPHLSVYRNIAYGLRNVERVERDRRVREMAEKLGIAHLL 
         :                                                                                                                          
 2onk(B) : MFLKVRAEKRLGNFRLNVDFEMGRDYCVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLPPERRGIGFVPQDYALFPHLSVYRNIAYGLRNVERVERDRRVREMAEKLGIAHLL 
           __________________________________________44___________________65_______________________________________________________ 

           ________________________________________________________________________________________________________________________ 
 2onk(A) : DRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVMLNGRIVEKGKLKELFSAKNGEVAEFLSARNLLLKVSKILD 
         :                                                                                                                          
 2onk(B) : DRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHVTHDLIEAAMLADEVAVMLNGRIVEKGKLKELFSAKNGEVAEFLSARNLLLKVSKILD 
           ________________________________________________________________________________________________________________________ 

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		0.9
Translation
(A) 		0.0
Closure
(%) 		27.0
Bending Residues
( green ) 		  44 - 48
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		1.3
Translation
(A) 		0.0
Closure
(%) 		67.2
Bending Residues
( green ) 		  65 - 69
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download