Proactivator Polypeptide

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Proactivator Polypeptide
  Conformer 1
(PDB) 		2gtg (A)
  Conformer 2
(PDB) 		1sn6 (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 41 2.22   24 - 64
2 33 1.97   4 - 23   65 - 77

Sequence


           ___________________21________________________________________63_____________________                                     
 2gtg(A) : *DVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCS*****                                     
         :                                                                                                                          
 1sn6(A) : SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEVSPELVCSMLHLCSGLVPR                                     
           ___________________21________________________________________63_____________________                                     

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		108.4
Translation
(A) 		1.8
Closure
(%) 		67.0
Bending Residues
( green ) 		  21 - 24
  63 - 67
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download