Glutamate Receptor Subunit 2

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Glutamate Receptor Subunit 2
  Conformer 1
(PDB) 		1ftm (C)
  Conformer 2
(PDB) 		1my3 (C)
  Window Length 15
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 123 0.26   11 - 106   174 - 174   220 - 242   246 - 246   249 - 249   254 - 254
2 121 0.25   107 - 173   175 - 219   243 - 245   247 - 248   250 - 253

Sequence


           ____________________________________________________________________________________________________106_________________ 
 1ftm(C) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
         :                                                                                                                          
 1my3(C) : KTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIES 
           ____________________________________________________________________________________________________106_________________ 

           _______________________________________________173___________________________________________219________________238____2 
 1ftm(C) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
         :                                                                                                                          
 1my3(C) : AEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGNAVNLAVLKLNE 
           _______________________________________________173___________________________________________219________________238____2 

           45_____253________                                                                                                       
 1ftm(C) : QGLLDKLKNKWWYDKGEC                                                                                                       
         :                                                                                                                          
 1my3(C) : QGLLDKLKNKWWYDKGEC                                                                                                       
           45_____253________                                                                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		1.8
Translation
(A) 		0.1
Closure
(%) 		97.5
Bending Residues
( green ) 		  106 - 107
  173 - 175
  219 - 220
  238 - 243
  245 - 250
  253 - 254
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download