Mad1 (Mitotic Arrest Deficient)-Like 1

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Mad1 (Mitotic Arrest Deficient)-Like 1
  Conformer 1
(PDB) 		1go4 (E)
  Conformer 2
(PDB) 		1go4 (F)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 42 1.39   536 - 577
2 36 1.36   495 - 530

Sequence


           _________________________________528___________________________________________________                                  
 1go4(E) : FSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAME                                  
         :                                                                                                                          
 1go4(F) : FSREEADTLRLKVEELEGERSRLEEEKRMLEAQLERRALQGDYDQSRTKVLHMSLNPTSVARQRLREDHSQLQAECERLRGLLRAME                                  
           _________________________________528___________________________________________________                                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		45.8
Translation
(A) 		5.9
Closure
(%) 		99.6
Bending Residues
( green ) 		  528 - 537
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

PyMOL Script

Download and extract PyMOL PML script file Download